TMEM247

Transmembrane protein 247 (also known as TMEM247 or transmembrane protein ENSP00000343375) is a multi-pass transmembrane protein of unknown function found in Homo sapiens encoded by the TMEM247 gene. Notable in the protein are two transmembrane regions near the c-terminus of the translated polypeptide. Transmembrane protein 247 has been found to be expressed almost entirely in the testes.[5]

TMEM247
Identifiers
AliasesTMEM247, transmembrane protein 247
External IDsMGI: 1925719 HomoloGene: 54379 GeneCards: TMEM247
Orthologs
SpeciesHumanMouse
Entrez

388946

78469

Ensembl

ENSG00000284701

ENSMUSG00000037689

UniProt

A6NEH6

Q497K7

RefSeq (mRNA)

NM_001145051

NM_001277980
NM_030104

RefSeq (protein)

NP_001138523

NP_001264909
NP_084380

Location (UCSC)Chr 2: 46.48 – 46.48 MbChr 17: 87.22 – 87.23 Mb
PubMed search[3][4]
Wikidata
View/Edit HumanView/Edit Mouse

Gene attributes

General information

The TMEM247 gene is located on chromosome 2 at c2p21, nucleotide: 46,479,565-46,484,425. It has three exons and two introns. TMEM247 is 4,861 nucleotides (nt) long pre-mRNA processing, reduced to 661 nt after mRNA processing and its protein product is 219 amino acids (aa) long.[6] The gene does not include a stop codon as most genes do, but instead has a stop codon created by the process of polyadenylation during mRNA processing. Due to this, TMEM247 has no 3' UTR (untranslated region). TMEM247 codes only for one variant.

Promoter region

The promoter region of TMEM247 has a huge variety of predicted binding sites in the promoter region associated with the gene. Twenty potential interactions of interest have been collected below, though many more exist. Anchor base positions are based on distance from the start of the gene's promoter region, which itself is 1302 base pairs long.

There are a number of notable predicted binding sites on the TMEM247 promoter, as well as a notable omission. The promoter lacks a traditional TATA box, the typical binding site for proteins that recruit RNA Polymerase and begin the process of transcription. Instead, TMEM247 contains several predicted binding sites which are core promoter elements for TATA-less promoters.

TMEM247 has a promoter region that also contains a significant number of predicted development-related binding sites, such as pluripotent stem cell related factors (Oct4, Sox2, Nanog), sex-determining HMG box factors, and various homeobox/homeodomain binding sites.[7]

Tail end of the promoter region of the TMEM247 gene with notable predicted binding sites highlighted. The start of transcription is marked by an arrow.
MatrixDetailed matrix informationAnchor baseStrandMatrix similaritySequence
V$TBX5.01Brachyury gene, mesoderm developmental factor1040(+)1ctacctcaaaGGTGtcacaccctccacca
V$EOMES.03Brachyury gene, mesoderm developmental factor1042(-)0.987tttggtggagggTGTGacacctttgaggt
V$PDEF.01Human and murine ETS1 factors (Prostate-derived Ets Factor)998(-)0.974gaactgcaGGATgggcctttg
V$RFX3.01X-box binding factors1064(+)0.974aaggggccctagCAACttg
V$SPZ1.01Testis-specific bHLH-Zip transcription factors (Spermatogenic Zip 1 transcription factor)1046(-)0.966tGGAGggtgtg
V$TBX20.02Brachyury gene, mesoderm developmental factor1149(-)0.939catcatttgaggtgctGACAtttggcctc
V$HSF1.05Heat shock factors1198(-)0.938ctgctgccatCCAGaaaaccagaac
V$MYOD.01Myogenic regulatory factor MyoD (myf3)1178(-)0.919cgctGCCAggtggggtc
V$MTBF.01Human muscle-specific Mt binding site1128(+)0.906tggaATCTg
V$RFX3.02Regulatory factor X, 3 (secondary DNA binding preference)1278(+)0.889gatggtgcctgGTGActcc
V$OCT3_4.02Motif composed of binding sites for pluripotency or stem cell factors892(+)0.882acaatctTCATttaaaaaa
V$HSF1.01Heat shock factors1190(-)0.845atccagaaaaccAGAAcgctgccag
V$EN1.01Homeobox transcription factors897(-)0.832gttcctttTTTAaatgaag
O$XCPE1.01Activator-, mediator- and TBP-dependent core promoter element for RNA polymerase II transcription from TATA-less promoters1243(+)0.831gtGCGGgagaa
V$DICE.01Downstream Immunoglobulin Control Element, critical for B cell activity and specificity1091(-)0.827tgtcGTCAtcatagc
V$ISL1.01Lim homeodomain factors1012(+)0.827tgcagttctTAATgttagcatgt
V$RFX4.03X-box binding factors1064(-)0.814caaGTTGctagggcccctt
V$EN1.01Homeobox transcription factors922(+)0.788aaatggatTTCAaatggtg
V$SOX9.03SOX/SRY-sex/testis determining and related HMG box factors1061(+)0.786caCCAAaggggccctagcaactt
V$OSNT.01Composed binding site for Oct4, Sox2, Nanog, Tcf3 (Tcf7l1) and Sall4b in pluripotent cells1151(+)0.784aatgtcaGCACctcaaatg
V$PROX1.01Prospero-related homeobox1163(+)0.783aatGATGtcttgt
V$SOX9.03SOX/SRY-sex/testis determining and related HMG box factors975(+)0.781ttTCAAagccatccttatgggca
V$HSF2.03Heat shock factors1075(+)0.777ctagcaacttgtAGAAtgtaggcta
V$HSF5.01Heat shock factors1074(-)0.764agcctacatTCTAcaagttgctagg

Protein attributes

The TMEM247 gene codes for a single protein, transmembrane protein 247 (also referred to as TMEM247). TMEM247 has two transmembrane domains at the c-terminus of the protein as part of its multi-pass transmembrane protein structure. They are identical in length at 21 amino acids each, and are separated by a span of six amino acids.[8] TMEM247 has a predicted molecular weight of 25 kilodaltons, and a predicted isoelectric point of 5.[9]

In composition, TMEM247 has a significantly higher amount of methionine when compared to the set of all human proteins. It also has slightly elevated levels of glutamic acid in the same analysis. The charge distribution of amino acids comprising TMEM247 is relatively uniform. Two predicted hydrophobic segments exist in the protein which match with the known two transmembrane regions.[10][11]

Protein domains

Transmembrane protein 247 has two transmembrane domains. The three regions of the protein that remain are predicted to be outside of the membrane it resides in on the N- and C-terminus of the protein, while the segment between the protein's two transmembrane regions is predicted to reside inside of the membrane.[12][13]

Analysis of TMEM247 predicts that it localizes in the cell at the endoplasmic reticulum. In this case, inner predicted domains would be inside the ER and outer predicted domains would reside in the cytoplasm.

A domain-level view of TMEM247 with points of interest at predicted post-translational modification sites.

Predicted post-translational modifications

Transmembrane protein 247 has a variety of predicted post-translational modifications that may affect protein function. Predicted modifications include O-beta-GlcNAc attachment, Glycation, and O-glycosylation.[14][15][16]

A conceptual translation of TMEM247 and predicted modifications to its protein product

Predicted kinase interactions

Protein kinases may modify transmembrane protein 247, and a variety of sites along the translated protein have been predicted to be kinase binding sites. These are represented by red squares surrounding the potential bound amino acids in the conceptual translation and listed in the table below. Predicted kinase interactions are listed in the order of the score of their prediction (higher, lower).[17]

Amino acid positionKinases
17CKI
20PKC
29unspecified
31unspecified
43unspecified, DNAPK, ATM
48unspecified
49CKII, unspecified, DNAPK
50unspecified
72unspecified, cdk5, p38MAPK
75unspecified, PKC
79PKC, unspecified
95cdk5, p38MAPK, GSK3
98unspecified
161PKA
219PKA

Protein structure

Transmembrane protein 247 has a predicted secondary structure which includes two major features in the form of beta sheets that reside near its determined transmembrane regions. This is slightly unusual for transmembrane proteins, whose transmembrane regions are often alpha helices.[18][19]

A Chou-Fasman method prediction of TMEM247's secondary protein structure.
A 3D prediction of the TMEM247 secondary protein structure.

Evolutionary history

Orthologs

TMEM247 has several hundred orthologs, with its most distant fully sequenced available ortholog being Anolis carolinensis.[20][21] These orthologs are exclusive to land-based animals, as clades with an evolutionary origin before reptiles are not represented. The fact that TMEM247 has no relatives before the green anole makes it likely that the gene was novel when it appeared in an ancestor of the species, and was nonexistent before the evolution of reptiles. Classes represented in the orthologs include mammalia, aves, and reptilia.

Most orthologs within mammalia are strongly conserved across the entire gene, including a very highly conserved region near the center of the translated protein. The highest evolutionary conservation is centered around the transmembrane regions of the protein, which are highly conserved in all orthologous species.[22]

Genus and speciesCommon nameTaxonomic groupMYAAccession #Sequence length (aa)Sequence identity to humansSequence similarity to humans
Homo sapiensHumanPrimates0NP_001138523.1219100%100%
Tupaia chinensisTreeshrewScandentia82XP_006159980.126674%81%
Urocitellus parryiiArctic ground squirrelRodentia90XP_026241536.122471%77%
Cavia porcellusGuinea pigRodentia90XP_003472978.126269%77%
Vulpes vulpesRed foxCarnivora96XP_025848559.123176%80%
Sus scrofaWild boarArtiodactyla96XP_003125218.325774%78%
Pteropus alectoBlack flying foxChiroptera96XP_015442982.128069%78%
Myotis lucifugus Little brown batChiroptera96XP_006083536.121273%78%
Lynx canadensisCanadian lynxCarnivora96XP_030167645.121474%78%
Leptonychotes weddelliiWeddell sealCarnivora96XP_006740668.121476%81%
Equus caballusHorsePerissodactyla96XP_023474197.128674%78%
Enhydra lutris kenyoniSea otterCarnivora96XP_022371955.121476%80%
Canis lupus familiarisDogCarnivora96XP_005626294.123176%80%
Camelus ferusWild Bactrian camelArtiodactyla96XP_032353339.127673%78%
Bos taurusCattleArtiodactyla96NP_001070537.221773%78%
Bos indicus × Bos taurusHybrid cattleArtiodactyla96XP_027410252.125873%78%
Loxodonta africanaAfrican bush elephantProboscideans105XP_023413034.126573%78%
Echinops telfairiLesser hedgehog tenrecAfrosoricida105XP_004700102.121770%77%
Pelodiscus sinensisSoftshell turtleTestudines312XP_006125563.218446%60%
Columba liviaPigeonColumbiformes312XP_021154517.119544%62%
Chelonia mydasGreen sea turtleTestudines312XP_027681026.121338%55%
Antrostomus carolinensisChuck-will's-widowCaprimulgiformes312XP_028940116.115438%52%
Anolis carolinensisGreen anoleSquamata312XP_008115619.122333%50%

Paralogs

In humans, TMEM247 has a single paralog (hCG17037) that has a sequence which theoretically would translate into a protein which is identical to that produced by TMEM247 aside from seven positions constituting a 96.8% similarity, including two deletions that reduce the total amino acid count from 219 to 217.[23] The extreme similarity of the TMEM247 gene and its paralog make it a likely result of gene duplication.

Paralog alignment

CLUSTAL O(1.2.4) multiple sequence alignment of TMEM247 and its paralog, hCG17037

Significance/function

TMEM247 has no major known effects or uses in a clinical setting. There are several studies that indicate TMEM247, despite being found almost exclusively in the testes, does not play a significant role in reproduction.[24] Further studies have revealed an association with variants in TMEM247 and coronary artery disease, though not of major significance.[25]

A mutation in TMEM247 has been noted to be unusually common in populations of Tibetan highlanders. The exact mutation is rs116983452, a change at nucleotide position 248 in the gene from cystine to tyrosine, which causes a missense in the protein product of alanine to valine.[26]

While the function of TMEM247 is unknown, it is notable for its polyadenylation-synthesized stop codon. Some research has shown that genes which rely on polyadenylation for the creation of stop codons are relatively common in a human parasite, Blastocystis.[27]

References

  1. GRCh38: Ensembl release 89: ENSG00000284701 - Ensembl, May 2017
  2. GRCm38: Ensembl release 89: ENSMUSG00000037689 - Ensembl, May 2017
  3. "Human PubMed Reference:". National Center for Biotechnology Information, U.S. National Library of Medicine.
  4. "Mouse PubMed Reference:". National Center for Biotechnology Information, U.S. National Library of Medicine.
  5. TMEM247 transmembrane protein 247 [Homo sapiens (human)]—Gene—NCBI. (n.d.). Retrieved April 28, 2020, from https://www.ncbi.nlm.nih.gov/gene/388946
  6. Homo sapiens transmembrane protein 247 (TMEM247), mRNA (345842501). (2019). NCBI Nucleotide Database. http://www.ncbi.nlm.nih.gov/nuccore/NM_001145051.2
  7. Genomatix: Welcome to the Genomatix Software Suite! (n.d.). Retrieved March 29, 2020, from https://www.genomatix.de/cgibin/welcome/welcome.pl?s=ac7927c41e6305cdc1454d08ae910ad4
  8. Homo sapiens transmembrane protein 247 (TMEM247), mRNA (345842501). (2019). NCBI Nucleotide Database. http://www.ncbi.nlm.nih.gov/nuccore/NM_001145051.2
  9. ExPASy—Compute pI/Mw tool. (n.d.). Retrieved April 20, 2020, from https://web.expasy.org/compute_pi/
  10. MitoProt II - v1.101. (n.d.). Retrieved April 20, 2020, from https://ihg.gsf.de/cgibin/paolo/mitofilter?seq=MAAEDREMMEARGAGESCPTFPKMVPGDSKSEGKPRAYLEAE SQKPDSSYDYLEEMEACEDGGCQGPLKS%0D%0ALSPKSCRATKGQAGDGPKPAELPPT PGTERNPEMELEKVRMEFELTRLKYLHEKNQRQRQHEVVMEQLQR%0D%0AERQHEV VMEQLQQEAAPRLFSGGLQNFLLPQNQFAMFLYCFIFIHIIYVTKEMVFFLFAKHYLFCIA AIL%0D%0ALCLIKTFWS&seqname=
  11. SAPS Results. (n.d.). Retrieved April 20, 2020, from https://www.ebi.ac.uk/Tools/services/web/toolresult.ebi?jobId=saps-I20200418-142058-098311033368-p1m
  12. TMHMM result. (n.d.). Retrieved April 20, 2020, from http://www.cbs.dtu.dk/cgibin/webface2.fcgi?jobid=5E9CC91C00001F03029DB033&wait=20
  13. Phobius. (n.d.). Retrieved April 20, 2020, from http://phobius.sbc.su.se/
  14. NetGlycate 1.0 Server—Prediction results. (n.d.). Retrieved April 20, 2020, from http://www.cbs.dtu.dk/cgi-bin/webface2.fcgi?jobid=5E9CCC4300001F0306A57D84&wait=20
  15. NetOGlyc 4.0 Server—Prediction results. (n.d.). Retrieved April 20, 2020, from http://www.cbs.dtu.dk/cgi-bin/webface2.fcgi?jobid=5E9CCD2200001F033FFFF880&wait=20
  16. YinOYang 1.2 Server. (n.d.). Retrieved April 20, 2020, from http://www.cbs.dtu.dk/services/YinOYang/
  17. NetPhos 3.1 Server—Prediction results. (n.d.). Retrieved April 20, 2020, from http://www.cbs.dtu.dk/cgi-bin/webface2.fcgi?jobid=5E9CCE08000067A5DE7F60BB&wait=20
  18. Phyre Investigator output for TMEM247__ with c5mv0D_. (n.d.). Retrieved May 3, 2020, from http://www.sbg.bio.ic.ac.uk/phyre2/phyre2_output/055ce555bf871a7d/investigator/c5mv0D_.1/summary.html
  19. CFSSP: Chou & Fasman Secondary Structure Prediction Server. (n.d.). Retrieved April 20, 2020, from https://www.biogem.org/tool/chou-fasman/
  20. BLAST: Basic Local Alignment Search Tool. (n.d.). Retrieved May 1, 2020, from https://blast.ncbi.nlm.nih.gov/Blast.cgi
  21. UCSC Genome Browser Gateway. (n.d.). Retrieved May 1, 2020, from https://genome.ucsc.edu/cgi-bin/hgGateway,
  22. EMBOSS Needle—Alignment. (n.d.). Retrieved February 9, 2020, from https://www.ebi.ac.uk/Tools/services/web/toolresult.ebi?jobId=emboss_needle-I20200210030452-0663-36912718-p1m
  23. HCG17037, partial [Homo sapiens]—Protein—NCBI. (n.d.). Retrieved May 1, 2020, from https://www.ncbi.nlm.nih.gov/protein/119620659/
  24. Miyata, H., Castaneda, J. M., Fujihara, Y., Yu, Z., Archambeault, D. R., Isotani, A., Kiyozumi, D., Kriseman, M. L., Mashiko, D., Matsumura, T., Matzuk, R. M., Mori, M., Noda, T., Oji, A., Okabe, M., Prunskaite-Hyyrylainen, R., Ramirez-Solis, R., Satouh, Y., Zhang, Q., … Matzuk, M. M. (2016). Genome engineering uncovers 54 evolutionarily conserved and testis-enriched genes that are not required for male fertility in mice. Proceedings of the National Academy of Sciences, 113(28), 7704–7710. https://doi.org/10.1073/pnas.1608458113
  25. van der Harst Pim, & Verweij Niek. (2018). Identification of 64 Novel Genetic Loci Provides an Expanded View on the Genetic Architecture of Coronary Artery Disease. Circulation Research, 122(3), 433–443. https://doi.org/10.1161/CIRCRESAHA.117.312086
  26. Deng, L., Zhang, C., Yuan, K., Gao, Y., Pan, Y., Ge, X., He, Y., Yuan, Y., Lu, Y., Zhang, X., Chen, H., Lou, H., Wang, X., Lu, D., Liu, J., Tian, L., Feng, Q., Khan, A., Yang, Y., … Xu, S. (2019). Prioritizing natural-selection signals from the deep-sequencing genomic data suggests multi-variant adaptation in Tibetan highlanders. National Science Review, 6(6), 1201–1222. https://doi.org/10.1093/nsr/nwz108
  27. Venton, D. (2014). Highlight: Not Like a Textbook--Nuclear Genes in Blastocystis Use mRNA Polyadenylation for Stop Codons. Genome Biology and Evolution, 6(8), 1962–1963. https://doi.org/10.1093/gbe/evu167
This article is issued from Wikipedia. The text is licensed under Creative Commons - Attribution - Sharealike. Additional terms may apply for the media files.